PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010935812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 689aa    MW: 76328.3 Da    PI: 4.153
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010935812.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.4e-52251531129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtd+elv++yLk+kv+gk+l++ ++i+e+d+yk+ePwdLp  +++ +++ ewyfFs+ d+ky++ +r nr+t++gyWk+tgkd+++ 
  XP_010935812.1  25 LAPGFRFHPTDDELVSYYLKRKVSGKSLRI-DAIAEIDLYKCEPWDLPplSRIVSRDLEWYFFSPLDRKYSNRSRMNRSTAQGYWKTTGKDRPIR 118
                     579***************************.99**************96558888899************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + ++++vg+kktLv++ grap+ge+t+Wvmheyrle
  XP_010935812.1 119 H-NHRVVGMKKTLVYHAGRAPRGERTNWVMHEYRLE 153
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6020179IPR003441NAC domain
PROSITE profilePS5100557.53225179IPR003441NAC domain
PfamPF023656.0E-2827152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MNGGASSSNP RRPVAPATPA AATQLAPGFR FHPTDDELVS YYLKRKVSGK SLRIDAIAEI  60
DLYKCEPWDL PPLSRIVSRD LEWYFFSPLD RKYSNRSRMN RSTAQGYWKT TGKDRPIRHN  120
HRVVGMKKTL VYHAGRAPRG ERTNWVMHEY RLEDQELAGT VTCTGIPQDA YVVCRIFKKS  180
GQGPQNGAQY GAPFNEEEWE ETDGGMIMLR DDGDDDFFDA GEQEQEYLQM NDFLQNQYPD  240
NQHANDSGFV VDPNLQDSGS HQEDPSVLLE EILNDPSFGN DMVEHTDERG LQNGPALGND  300
MGQNIGMADS SYTAGQNEGY VELNDLADTV NAEDPPSEDS VGCSSWTCND WKPVDGVDDI  360
INFQEILDVD EFFDTVNEDI NQPELFQMSP PLSDNYDMQP IDIRNFLAGD CPSGQLAEGN  420
TMFYDADSND LAFAQDNFAE LNHLLDLPIS DPSRFDMVDN LMAYFDAMDD NLHVDTAGFL  480
ENSGCMNSSI LDQFNLTPEF DGINAQPNEV IPWASEANVA SGPSSSLRLP DADNQLKTEN  540
DVNIKLDVKR SESNGKTITK RLVNMLGSIS APPAIAAEYP VRSEKPVGQI SETHSASSIH  600
FTAGMIQIRG LTVTGSTEHW SLQKNGDVDF LLSYGMDGDE ARKSIGFEPI SKIQGGLASV  660
VLRGGFYLFF LSALILTVSY GVGLCICSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-512118211171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010935812.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
TrEMBLM0S4Z20.0M0S4Z2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04010_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.13e-85NAC domain containing protein 2